PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 435aa    MW: 50243.3 Da    PI: 6.1439
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603629.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.4e-16196242148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++v+++G + W+ Ia+ +  gR +kqc++rw+++l
   XP_009603629.1 196 KGQWTIEEDRLLIHLVEKFGVRKWSQIAQLLK-GRIGKQCRERWHNHL 242
                      799****************************9.*************97 PP

2Myb_DNA-binding56.94.9e-18250290345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd +l++a+++ G++ W+ Ia++++ gRt++++k++w+
   XP_009603629.1 250 LWTEEEDRILIEAHAEVGNK-WAEIAKRLP-GRTENSIKNHWN 290
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.628191246IPR017930Myb domain
SMARTSM007173.5E-15195244IPR001005SANT/Myb domain
SuperFamilySSF466891.14E-31196289IPR009057Homeodomain-like
PfamPF002499.8E-16196242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-27197249IPR009057Homeodomain-like
CDDcd001671.28E-13199242No hitNo description
SMARTSM007176.8E-18247295IPR001005SANT/Myb domain
PROSITE profilePS5129422.892247297IPR017930Myb domain
PfamPF002499.4E-17250290IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-23250296IPR009057Homeodomain-like
CDDcd001671.01E-13251293No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MELDPSNKQD LSFHPIFVPN NNSLKPELDD DFCIDSKDYF QDFQHLDLNF SLSGGVLPNY  60
TFNNTENFMI DTNGYDPFDP FSNEDNFSSL GDFNFSYELK PFDEENGNTI KENPMDVNYT  120
YNGSCFNSLS CEDVKPLNFV VPDQSSSCVT NGSNCKLEIG ELRKNKKVKR NDQSYLLSSS  180
MKKLGRGRNK KSKSAKGQWT IEEDRLLIHL VEKFGVRKWS QIAQLLKGRI GKQCRERWHN  240
HLRPDIKKDL WTEEEDRILI EAHAEVGNKW AEIAKRLPGR TENSIKNHWN ATKRRQFSRR  300
KCRTKWPRPS SLLQNYIKSL NLEKGSSKKN SQTCNATNSS AKVKVSTKPE ATDQFCQGNM  360
EQVRDFDFSE VPEFALDDKF FEENTMNSFM EDMHVGPNST MEKCMGLEII PYELRQGEVS  420
NKEIDLMEMI SGVNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-451962964104C-Myb DNA-Binding Domain
1msf_C1e-451962964104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2192102e-79AC219210.1 Solanum lycopersicum chromosome 6 clone C06HBa0082B05, complete sequence.
GenBankAC2329442e-79AC232944.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 6 clone LE_HBa-24A16, complete sequence.
GenBankHG9755182e-79HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603629.10.0PREDICTED: transcription factor MYB98-like
TrEMBLK4C8M41e-160K4C8M4_SOLLC; Uncharacterized protein
STRINGSolyc06g071520.1.11e-160(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-80myb domain protein 98